PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.007G069200.1
Common NamePHAVU_007G069200g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 271aa    MW: 30594.6 Da    PI: 8.5709
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.007G069200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.71.8e-151562148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g W++eEd +l +++ ++G g+W++++ + g+ R +k+c++rw +yl
  Phvul.007G069200.1 15 KGLWSPEEDNKLRNYILKHGHGCWSSVPIKAGLQRNGKSCRLRWINYL 62
                        678*******************************************97 PP

2Myb_DNA-binding54.92e-1768113148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         rg+++++E+e ++ ++++lG++ W+ I+++++ gRt++++k++w++yl
  Phvul.007G069200.1  68 RGKFSKQEEETILTLHHMLGNK-WSQISQHLP-GRTDNEIKNYWHSYL 113
                         89********************.*********.************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.4141062IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-221065IPR009057Homeodomain-like
SuperFamilySSF466895.5E-2912109IPR009057Homeodomain-like
SMARTSM007171.1E-111464IPR001005SANT/Myb domain
PfamPF002495.2E-141562IPR001005SANT/Myb domain
CDDcd001677.25E-101862No hitNo description
PROSITE profilePS5129426.37363117IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.5E-2666117IPR009057Homeodomain-like
SMARTSM007172.3E-1667115IPR001005SANT/Myb domain
PfamPF002491.3E-1668113IPR001005SANT/Myb domain
CDDcd001673.98E-1170113No hitNo description
PROSITE patternPS000860215224IPR017972Cytochrome P450, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0055114Biological Processoxidation-reduction process
GO:0003677Molecular FunctionDNA binding
GO:0016705Molecular Functionoxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MGCQPLEKGK PKHKKGLWSP EEDNKLRNYI LKHGHGCWSS VPIKAGLQRN GKSCRLRWIN  60
YLRPGLKRGK FSKQEEETIL TLHHMLGNKW SQISQHLPGR TDNEIKNYWH SYLKKKVAKA  120
KEMDFHNQMK YASSSSDTMD SSNSLQKLAT QGTQNFNFTN EACQSSLPKL LFAEWLSLDQ  180
VNSANTVDSF GLRNGLDQNS TLEEASIHDM SEVPFGGGYH RCLANISAPE MFNSELKYAN  240
EMVENGFIHC VPGVDLSSNF SMSNDGIMYI *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-2391171108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0977340.0BT097734.1 Soybean clone JCVI-FLGm-16G14 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007143397.10.0hypothetical protein PHAVU_007G069200g
SwissprotQ9M0K41e-60LAF1_ARATH; Transcription factor LAF1
TrEMBLV7BFX60.0V7BFX6_PHAVU; Uncharacterized protein
STRINGGLYMA10G38110.11e-170(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38303161
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G48920.14e-61myb domain protein 45